PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 864377
Common NameARALYDRAFT_663821
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 306aa    MW: 33945.6 Da    PI: 9.471
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
864377genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.95.4e-1461105147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT +E++++++a +++  + Wk+I + +g  +t  q++s+ qky
           864377  61 RENWTDQEHDKFLEALHLFDRD-WKKIEAFVG-SKTVVQIRSHAQKY 105
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.97E-1755111IPR009057Homeodomain-like
PROSITE profilePS5129415.20656110IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.2E-758111IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-1759108IPR006447Myb domain, plants
SMARTSM007173.3E-1160108IPR001005SANT/Myb domain
PfamPF002496.7E-1261105IPR001005SANT/Myb domain
CDDcd001679.17E-963106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MVSVNPRPKG FPMFDPVNMS LPGSDGFGSN PIATIPATGR VSFSEDPTTK IRKPYTIKKS  60
RENWTDQEHD KFLEALHLFD RDWKKIEAFV GSKTVVQIRS HAQKYFLKVQ KSGANEHLPP  120
PRPKRKASHP YPIKAPKKVA FTSHVLPSSS TLPLLEPGYL YSSDSQPLLG NQAVCASSSS  180
SWNHESTNLL PKPVIEVEEP GVSATAPLPK NHCSEEDTRR VRAVTKPNGE ESCEKPHRVM  240
PNFAEVYSFI GSVFDPNTSG HLQRLKQMDP INMETVLLLM QNLSVNLTNP EFAEQISSYS  300
AKALK*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00423DAPTransfer from AT4G01280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4936680.0AB493668.1 Arabidopsis thaliana At4g01280 mRNA for hypothetical protein, partial cds, clone: RAAt4g01280.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002874991.10.0predicted protein
SwissprotC0SVG50.0RVE5_ARATH; Protein REVEILLE 5
TrEMBLD7M4X20.0D7M4X2_ARALL; Predicted protein
STRINGAl_scaffold_0006_38860.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12902893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.20.0MYB_related family protein